Home | MS-Fit | MS-Tag | MS-Seq | MS-Pattern | MS-Bridge | MS-Digest | MS-Product | MS-Comp | DB-Stat | MS-Isotope | MS-Homology
Batch-Tag | Batch-Tag Web | Search Compare | Results Management | Search Table | Logout

Database User Protein NCBInr.2009.03.24 NCBInr.2009.03.24.random.concat NCBInr.2009.07.10 NCBInr.refseq.2009.09.14 NCBInr.refseq.2009.09.14.random SwissProt.2009.03.24 SwissProt.2009.03.24.random.concat SwissProt.2009.07.07 UniProtKB.2009.03.24 UniProtKB.2009.03.24.random.concat UniProtKB.2009.07.07 Output HTML XML Hits to file Name	Retrieve Entry by Index Number Accession Number
Digest Trypsin TrypsinPro SlymotrypsinFYWKR Chymotrypsin Chymotrypsin FYW ChymotrypsinFWYMEDLN V8 DE V8 E Lys-C Lys-N Arg-C Asp-N Asp-C DE-N CNBr Pepsin(porcine gastric) Glu-C Tyr-C Thermolysin Full Protein Pro-C CNBr/Trypsin CNBr/V8 DE CNBr/V8 E CNBr/Lys-C CNBr/Asp-N CNBr/Asp-C CNBr/Arg-C CNBr/V8 E CNBr/Trypsin/V8 DE CNBr/Trypsin/V8 E CNBr/Arg-C/V8 E CNBr/Lys-C/V8 E Trypsin/Asp-N Trypsin/DE-N Trypsin/V8 DE Trypsin/V8 E Trypsin/Glu-C Chymotrypsin/Arg-C Lys-C/Trypsin Lys-C/V8 DE Lys-C/V8 E Lys-C/Asp-N V8 DE/Chymotrypsin Arg-C/V8 E Max. Missed Cleavages [-] End Terminus Parameters End Terminus Stripping Terminal N C Stripping Range to Constant Mods Acetohydrazide (C-term) Acetohydrazide (DE) Acetyl (K) Acetyl (N-term) Acetyl:2H(3) (K) Acetyl:2H(3) (N-term) Amidated (C-term) Amidated+iTRAQ8plex (C-term) Amino (Y) Asn->Succinimide (N) Biotin (N-term) Carbamidomethyl (C) Carbamidomethyl (N-term) Carbamyl (K) Carbamyl (N-term) Carboxy (W) Carboxymethyl (C) Cys->Dha (C) Deamidated (N) Deamidated (Q) Dehydrated (D) Dehydrated (ST) Dehydro (C) Delta:2H(6)C(3) (K) Delta:2H(6)C(3) (N-term) Delta:H(2)C(3) (K) Delta:H(4)C(3)O(1) (C) Delta:H(4)C(3)O(1) (CHK) Delta:H(4)C(6) (K) Delta:H(6)C(3) (K) Delta:H(6)C(3) (N-term) Delta:H(6)C(6)O(1) (K) Delta:H(8)C(6)O(2) (K) Dethiomethyl (M) Dimethyl (N-term) Dioxidation (M) Dioxidation (W) DTT_C (C) DTT_C:2H(6) (C) DTT_ST (ST) DTT_ST:2H(6) (ST) Formyl (K) Formyl (N-term) GirardT (N) GlyGly (C) GlyGly (N-term) GlyTyr (N-term) Guanidinyl (K) HexNAc (ST) HexNAcHex (ST) HexNAcHexSA (ST) Hydroxymethyl (CRWHKNQY) ICAT-C (C) ICAT-C:13C(9) (C) ICAT-D (C) ICAT-D:2H(8) (C) IDEnT (C) iTRAQ4plex (K) iTRAQ4plex (N-term) iTRAQ4plex (Y) iTRAQ8plex (K) iTRAQ8plex (N-term) Label:13C(6) (K) Label:13C(6) (L) Label:13C(6) (R) Label:13C(6)15N(1) (L) Label:13C(6)15N(2) (K) Label:13C(6)15N(2)+Carbamyl (K) Label:13C(6)15N(4) (R) Label:18O(1) (C-term) Label:18O(2) (C-term) Label:2H(3) (L) Methyl (C-term) Methyl (DE) Methyl (E) Methyl (H) Methyl (K) Methyl (R) Methyl:13C(1)2H(3) (C-term) Methyl:13C(1)2H(3) (DE) Methylthiol (C) Nethylmaleimide (C) Nitro (Y) Oxidation (M) Oxidation (P) Oxidation (PWY) Oxidation (W) Oxidation (Y) PEO-Iodoacetyl-LC-Biotin (C) Phospho (ST) Phospho (STY) Phospho (Y) Propionamide (C) Pyridylethyl (C) Quinone (W) SerTyr (N-term) SerTyr+iTRAQ (N-term) SerTyrLys(OAc) (N-term) SerTyrLys(OAcs) (N-term) Sulfo (Y) TMT (K) TMT (N-term) TMT2plex (K) TMT2plex (N-term) TMT6plex (K) TMT6plex (N-term) Trioxidation (C) Trp->Hydroxykynurenin (W) Trp->Kynurenin (W) Xlink:BSSA1 (N-term) Xlink:BSSA2 (N-term) Xlink:DSS1 (N-term) Xlink:DSS2 (N-term) Xlink:FCXL1-1 (N-term) Xlink:FCXL1-2 (N-term) [-] Present Amino Acids(see instructions) OR AND A C D E F G H I K L M N P Q R S T V W Y	List of Entries(see instructions) P15497
Variable Mods Acetohydrazide (C-term) Acetohydrazide (DE) Acetyl (K) Acetyl (Protein N-term) Acetyl+Oxidation (Protein N-term M) Acetyl:2H(3) (K) Acetyl:2H(3) (N-term) Amidated (C-term) Amidated+iTRAQ8plex (C-term) Amino (Y) Asn->Succinimide (N) Biotin (N-term) Biotin (Uncleaved K) Carbamidomethyl (C) Carbamidomethyl (N-term) Carbamidomethyl (Uncleaved DEHKM) Carbamidomethyl (Uncleaved HKM) Carbamyl (K) Carbamyl (N-term) Carboxy (W) Carboxymethyl (C) Cation:N(1)H(4) (Neutral loss) Cys->Dha (C) Deamidated (N) Deamidated (Q) Dehydrated (D) Dehydrated (ST) Dehydro (C) Delta:2H(6)C(3) (K) Delta:2H(6)C(3) (N-term) Delta:H(2)C(3) (K) Delta:H(4)C(3)O(1) (C) Delta:H(4)C(3)O(1) (CHK) Delta:H(4)C(6) (K) Delta:H(6)C(3) (K) Delta:H(6)C(3) (N-term) Delta:H(6)C(6)O(1) (K) Delta:H(8)C(6)O(2) (K) Dethiomethyl (M) Dimethyl (N-term) Dimethyl (Uncleaved K) Dimethyl (Uncleaved R) Dioxidation (M) Dioxidation (W) Disuccinyl (Uncleaved K) DTT_C (C) DTT_C:2H(6) (C) DTT_ST (ST) DTT_ST:2H(6) (ST) Formyl (K) Formyl (N-term) GirardT (N) Gln->pyro-Glu (N-term Q) Glu->pyro-Glu (N-term E) GluGlnIleGlyGly (Uncleaved K) GlyGly (C) GlyGly (N-term) GlyGly (Uncleaved K) GlyTyr (N-term) Guanidinyl (K) HexNAc (ST) HexNAcHex (ST) HexNAcHexSA (ST) HNE (Uncleaved CHKPRT) HNE+Delta:H(2) (Uncleaved CHKPRT) HNE-Delta:H(2)O (Uncleaved CHKPRT) Hydroxymethyl (CRWHKNQY) ICAT-C (C) ICAT-C:13C(9) (C) ICAT-D (C) ICAT-D:2H(8) (C) IDEnT (C) iTRAQ4plex (K) iTRAQ4plex (N-term) iTRAQ4plex (Y) iTRAQ8plex (K) iTRAQ8plex (N-term) Label:13C(6) (K) Label:13C(6) (L) Label:13C(6) (R) Label:13C(6)+GlyGly (Uncleaved K) Label:13C(6)15N(1) (L) Label:13C(6)15N(2) (K) Label:13C(6)15N(2)+Carbamyl (K) Label:13C(6)15N(2)+GluGlnIleGlyGly (Uncleaved K) Label:13C(6)15N(2)+GlyGly (Uncleaved K) Label:13C(6)15N(4) (R) Label:18O(1) (C-term) Label:18O(2) (C-term) Label:2H(3) (L) LeuArgGlyGly (Uncleaved K) Met->Hsl (C-term M) Met-loss (Protein N-term M) Met-loss+Acetyl (Protein N-term M) Met-loss+Myristoyl (Protein N-term M) Methyl (C-term) Methyl (DE) Methyl (E) Methyl (H) Methyl (K) Methyl (R) Methyl:13C(1)2H(3) (C-term) Methyl:13C(1)2H(3) (DE) Methylthiol (C) Myristoyl (N-term G) Myristoyl (Uncleaved KR) Nethylmaleimide (C) NHS-LC-Biotin (Uncleaved K) Nitro (Y) Oxidation (M) Oxidation (P) Oxidation (PWY) Oxidation (W) Oxidation (Y) PEO-Iodoacetyl-LC-Biotin (C) Phospho (ST) Phospho (STY) Phospho (Y) Propionamide (C) PyridoxalPhosphate (Uncleaved K) Pyridylethyl (C) Quinone (W) SerTyr (N-term) SerTyr+iTRAQ (N-term) SerTyrLys(OAc) (N-term) SerTyrLys(OAcs) (N-term) Succinyl (Uncleaved K) Sulfo (Y) TMT (K) TMT (N-term) TMT2plex (K) TMT2plex (N-term) TMT6plex (K) TMT6plex (N-term) TriMethyl (Uncleaved K) Trioxidation (C) Trisuccinyl (Uncleaved K) Trp->Hydroxykynurenin (W) Trp->Kynurenin (W) Xlink:BSSA1 (Protein N-term) Xlink:BSSA1 (Uncleaved K) Xlink:BSSA2 (Protein N-term) Xlink:BSSA2 (Uncleaved K) Xlink:DSA1 (Uncleaved K) Xlink:DSA2 (Uncleaved K) Xlink:DSS1 (Protein N-term) Xlink:DSS1 (Uncleaved K) Xlink:DSS2 (Protein N-term) Xlink:DSS2 (Uncleaved K) Xlink:FCXL1-1 (Protein N-term) Xlink:FCXL1-1 (Uncleaved K) Xlink:FCXL1-2 (Protein N-term) Xlink:FCXL1-2 (Uncleaved K) Contaminant Masses	Link Search Type No Link Xlink:Dehydro (C) DSS FCXL1 BSSA GKIB User Defined Link Maximum Link Molecules [-] User Defined Link Parameters (see instructions) Link AAs C->C K,Protein N-term->K,Protein N-term K,Protein N-term->Q Bridge Elem Comp Mod 1 Label C K Q Protein N-term Mod 1 Elem Comp Mod 2 Label C K Q Protein N-term Mod 2 Elem Comp Mod 3 Label C K Q Protein N-term Mod 3 Elem Comp Mod 4 Label C K Q Protein N-term Mod 4 Elem Comp
Masses are monoisotopic average Tol Da % ppm mmu Sys Err	Hide Protein Sequences Hide HTML Links Display Graph Separate Proteins
For digestion of a user supplied sequence select User Protein above.
User Protein Sequence RVCMGKSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC
User Specified AA Elem Comp (u) User Specified AA Elem Comp (v) User Specified AA Elem Comp (w) User Specified AA Elem Comp (x)
Instrument ESI-Q-TOF ESI-ION-TRAP-low-res ESI-FT-ICR-CID ESI-FT-ICR-ECD ESI-ETD-low-res MALDI-Q-TOF MALDI-TOFTOF Data Format PP M/Z Charge PP M/Z Intensity Charge Data Paste Area 1347.5309 2222.8939 2435.2433 3344.3744 3573.6221 3620.6058 3683.7694 3698.5582 3725.6378 3848.7644

This program is the confidential and proprietary product of The Regents of the University of California. Any unauthorized reproduction or transfer of this program is strictly prohibited.
© Copyright (1999-2009) The Regents of the University of California. All rights reserved.